{"product_id":"proteintech-81609-1-rr","title":"Proteintech, 81609-1-RR, DMT1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe DMT1 (81609-1-RR) by Proteintech is a Recombinant antibody targeting DMT1 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n81609-1-RR targets DMT1 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  HEK-293 cells,  HuH-7 cells,  Caco-2 cells,  Neuro-2a cells,  HSC-T6 cells\nPositive IP detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC11A2 (also known as DMT1, Nramp2, and DCT1) is a member of the divalent cation transporters that plays a central role in iron homeostasis. SLC11A2 is widely expressed in many tissues including brain, kidney, testis, duodenum and placenta. As a membrane protein, SLC11A2 is localized on the apical membrane of enterocytes as well as in transferrin-cycle endosomes. Four isoforms of SLC11A2 exist due to the alternative splicing. They differ at the NH2 and COOH termini but share a common central domain. A variety of molecular weights of SLC11A2 in western blot analysis, ranging from 50 to 100 kDa, has been reported in different cells and species. The differences in molecular weights may be attributed to the level of glycosylation, proteolysis, or the membrane protein itself. This antibody detected various forms of SLC11A2 of 45-100 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag14314 Product name: Recombinant human SLC11A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC002592 Sequence: MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYSCFSFRKLWAFTGPGFLM Predict reactive species\nFull Name: solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2\nCalculated Molecular Weight: 568 aa, 62 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC002592\nGene Symbol: DMT1\nGene ID (NCBI): 4891\nRRID: AB_2935564\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P49281\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888363557033,"sku":"81609-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-81609-1-rr","provider":"Iright","version":"1.0","type":"link"}