{"product_id":"proteintech-81893-1-rr","title":"Proteintech, 81893-1-RR, GP73\/GOLPH2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe GP73\/GOLPH2 (81893-1-RR) by Proteintech is a Recombinant antibody targeting GP73\/GOLPH2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n81893-1-RR targets GP73\/GOLPH2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  MCF-7 cells\nPositive IHC detected in: human stomach cancer tissue, human liver cancer tissue,  human ovarian  cancer,  human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:450-1:1800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGolgi phosphoprotein 2 (GOLPH2, also known as GP73 or GOLM1) is a resident Golgi type-II membrane protein. It is predominantly expressed in the epithelial cells of many human tissues. GOLPH2 traffics through endosomes and can be secreted into the circulation. Its expression is upregulated in a number of tumors and GOLPH2 could be a promising serum marker for hepatocellular carcinoma. We got 70-75 kDa in western blotting due to phosphorylation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag7207 Product name: Recombinant human GOLM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 36-400 aa of BC001740 Sequence: SRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL Predict reactive species\nFull Name: golgi membrane protein 1\nCalculated Molecular Weight: 45 kDa\nObserved Molecular Weight: 70-75 kDa\nGenBank Accession Number: BC001740\nGene Symbol: GP73\nGene ID (NCBI): 51280\nRRID: AB_2935589\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8NBJ4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888428306601,"sku":"81893-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-81893-1-rr","provider":"Iright","version":"1.0","type":"link"}