{"product_id":"proteintech-82016-1-rr","title":"Proteintech, 82016-1-RR, STAT1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe STAT1 (82016-1-RR) by Proteintech is a Recombinant antibody targeting STAT1 in WB, IHC, IF\/ICC, IP, ELISA, ChIP-qPCR applications with reactivity to human, mouse, rat samples\n82016-1-RR targets STAT1 in WB, IHC, IF\/ICC, IP, ELISA, ChIP-qPCR applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  A549 cells,  Jurkat cells,  K-562 cells,  NIH\/3T3 cells,  HSC-T6 cells\nPositive IP detected in: PC-3 cells\nPositive IHC detected in: human ovary tumor tissue, mouse spleen tissue,  mouse colon tissue,  rat colon tissue,  rat spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: IFN alpha treated HeLa cells\nPositive ChIP-qPCR detected in: IFN-γ -HT-1080 (50 ng\/ml, 30min) HT-1080 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\nCHIP-QPCR: CHIP-QPCR : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSTAT1 (signal transducers and activators of transcription 1) is a member of the STAT protein family.  In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. Various ligands, including interferons- and - , EGF, PDGF and IL-6, can activate STAT1. STAT1 protein mediates the expression of a variety of genes, which is thought to be important for cell viability in response to different cell stimuli and pathogens.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag0199 Product name: Recombinant human STAT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-230 aa of BC002704 Sequence: SQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQRFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNA Predict reactive species\nFull Name: signal transducer and activator of transcription 1, 91kDa\nCalculated Molecular Weight: 83 kDa\nObserved Molecular Weight: 84 kDa\nGenBank Accession Number: BC002704\nGene Symbol: STAT1\nGene ID (NCBI): 6772\nRRID: AB_2935597\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P42224\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888343240873,"sku":"82016-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-82016-1-rr","provider":"Iright","version":"1.0","type":"link"}