{"product_id":"proteintech-82137-1-rr","title":"Proteintech, 82137-1-RR, DHX15 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe DHX15 (82137-1-RR) by Proteintech is a Recombinant antibody targeting DHX15 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n82137-1-RR targets DHX15 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U-251 cells, HeLa cells,  U2OS cells,  A431 cells,  NIH\/3T3 cells,  C6 cells\nPositive IP detected in: NIH\/3T3 cells\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:1000-1:4000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDHX15, also named as DBP1 and DDX15, is a DExD\/H-box protein that has been identified in spliceosome, through its carboxyl (C)-terminal G-patch domain and stimulates the helicase activity of DHX15. DHX15 is a pre-mRNA processing factor involved in disassembly of spliceosomes after the release of mature mRNA. The MW of DHX15 is about 90-95kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag2895 Product name: Recombinant human DHX15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 147-517 aa of BC035974 Sequence: TDILVRHQSFVLVGETGSGKTTQIPQWCVEYMRSLPGPKRGVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTILKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEVVRQRSDLKVIVMSATLDAGKFQIYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEEEGDLLLFLTGQEEIDEACKRIKREVDDLGPEVGDIKIIPLYSTLPPQQQQRIFEPPPPKKQNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGSVVLQLKKL Predict reactive species\nFull Name: DEAH (Asp-Glu-Ala-His) box polypeptide 15\nCalculated Molecular Weight: 795 aa, 91 kDa\nObserved Molecular Weight: 90-95 kDa\nGenBank Accession Number: BC035974\nGene Symbol: DHX15\nGene ID (NCBI): 1665\nRRID: AB_3086467\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O43143\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888344453289,"sku":"82137-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-82137-1-rr","provider":"Iright","version":"1.0","type":"link"}