{"product_id":"proteintech-82210-1-rr","title":"Proteintech, 82210-1-RR, SIRT3 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SIRT3 (82210-1-RR) by Proteintech is a Recombinant antibody targeting SIRT3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat, pig samples\n82210-1-RR targets SIRT3 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse heart tissue,  rat heart tissue,  HepG2 cells,  HT-29 cells,  mouse liver tissue,  pig liver tissue,  rat liver tissue\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSirtuins are NAD+-dependent histone\/protein deacetylases (HDAC) and SIRT3 is the only sirtuin whose increased expression has been shown to correlate with an extended life span in humans. It is localized in the mitochondrial matrix, where it regulates the acetylation levels of metabolic enzymes, including acetyl coenzyme A synthetase 2. SIRT3 is stress-responsive and its increased expression protects myocytes from genotoxic and oxidative stress-mediated cell death.  full-length hSIRT3 (44 kDa) is an inert protein and that it is activated inside the mitochondria following deletion of 142 amino acids of the N-terminal segment. This processed form of SIRT3 is approximately 28 kDa and possesses deacetylase activity. The full SIRT3 is a 44 kDa protein and is processed by mitochondrial processing peptidase (MPP) to give a 28 kDa product.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag26280 Product name: Recombinant human SIRT3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 202-399 aa of BC001042 Sequence: GNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK Predict reactive species\nFull Name: sirtuin (silent mating type information regulation 2 homolog) 3 (S. cerevisiae)\nCalculated Molecular Weight: 44 kDa\nObserved Molecular Weight: 28-30 kDa\nGenBank Accession Number: BC001042\nGene Symbol: SIRT3\nGene ID (NCBI): 23410\nRRID: AB_3086470\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9NTG7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888378269865,"sku":"82210-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-82210-1-rr","provider":"Iright","version":"1.0","type":"link"}