{"product_id":"proteintech-82469-6-rr","title":"Proteintech, 82469-6-RR, Bcl2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Bcl2 (82469-6-RR) by Proteintech is a Recombinant antibody targeting Bcl2 in WB, IHC, IF-P, FC (Intra), ELISA applications with reactivity to mouse samples\n82469-6-RR targets Bcl2 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, mouse brain tissue,  mouse spleen tissue,  mouse heart tissue\nPositive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse spleen tissue, mouse thymus tissue,  human colon cancer tissue\nPositive FC (Intra) detected in: NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)-P: IF-P : 1:500-1:2000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBcl2 is a member of the B cell lymphoma 2 protein family. Members of this family regulate cell death in multiple cell types and can have either proapoptotic or antiapoptotic activities. The protein encoded by this gene inhibits mitochondrial-mediated apoptosis. This protein is an integral outer mitochondrial membrane protein that functions as part of signaling pathway that controls mitochondrial permeability in response to apoptotic stimuli. This protein may also play a role in neuron cell survival and autophagy. Abnormal expression and chromosomal translocations of this gene are associated with cancer progression in numerous tissues.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag24260 Product name: Recombinant mouse Bcl2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-236 aa of NM-009741 Sequence: MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK Predict reactive species\nFull Name: B-cell leukemia\/lymphoma 2\nCalculated Molecular Weight: 26 kDa\nObserved Molecular Weight: 26 kDa\nGenBank Accession Number: NM-009741\nGene Symbol: Bcl2\nGene ID (NCBI): 12043\nRRID: AB_3670523\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P10417\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888347271337,"sku":"82469-6-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-82469-6-rr","provider":"Iright","version":"1.0","type":"link"}