{"product_id":"proteintech-82671-1-rr","title":"Proteintech, 82671-1-RR, FNDC5 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe FNDC5 (82671-1-RR) by Proteintech is a Recombinant antibody targeting FNDC5 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat, pig samples\n82671-1-RR targets FNDC5 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, C2C12 cells,  mouse skeletal muscle tissue,  rat skeletal muscle tissue,  pig skeletal muscle tissue,  mouse stomach tissue,  rat stomach tissue\nPositive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nfibronectin type III domain containing 5(FNDC5) encodes 23 kDa protein, which is a membrane protein that is cleaved and secreted as a newly identified hormone, irisin. Exercise-induced FNDC5 gene expression in muscles was accompanied by a parallel increase in the concentration of circulating irisin, which in turn activates adipocyte thermogenic programs, leading to mitochondrial heat production and energy expenditure.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag29714 Product name: Recombinant human FNDC5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 103-153 aa of BC062297 Sequence: IIKDNEPNNNKEKTKSASETSTPEHQGGGLLRSKVRARPGPGWATLCLMLW Predict reactive species\nFull Name: fibronectin type III domain containing 5\nCalculated Molecular Weight: 212 aa, 24 kDa\nObserved Molecular Weight: 25-30 kDa\nGenBank Accession Number: BC062297\nGene Symbol: FNDC5\nGene ID (NCBI): 252995\nRRID: AB_3086499\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8NAU1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888370143401,"sku":"82671-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-82671-1-rr","provider":"Iright","version":"1.0","type":"link"}