{"product_id":"proteintech-82678-2-rr","title":"Proteintech, 82678-2-RR, DNMT1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe DNMT1 (82678-2-RR) by Proteintech is a Recombinant antibody targeting DNMT1 in WB, FC (Intra), ELISA applications with reactivity to human, rat samples\n82678-2-RR targets DNMT1 in WB, FC (Intra), ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, HEK-293T cells,  PC-12 cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDNA methylation is a major epigenetic modification that regulates gene expression. DNMT1, the maintenance DNA methylation enzyme, is the primary enzyme responsible for copying methylation patterns after DNA replication. DNMT1 is required for X chromosome inactivation, imprinting, genomic methylation, and proper embryonic development. Overexpression of DNMT1 has been reported in various cancers. (PMID: 10753866)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag29479 Product name: Recombinant human DNMT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 300-500 aa of BC126227 Sequence: KKHRSQPKDLAAKRRPEEKEPEKVNPQISDEKDEDEKEEKRRKTTPKEPTEKKMARAKTVMNSKTHPPKCIQCGQYLDDPDLKYGQHPPDAVDEPQMLTNEKLSIFDANESGFESYEALPQHKLTCFSVYCKHGHLCPIDTGLIEKNIELFFSGSAKPIYDDDPSLEGGVNGKNLGPINEWWITGFDGGEKALIGFSTSFA Predict reactive species\nFull Name: DNA (cytosine-5-)-methyltransferase 1\nCalculated Molecular Weight: 1632 aa, 185 kDa\nObserved Molecular Weight: 200 kDa\nGenBank Accession Number: BC126227\nGene Symbol: DNMT1\nGene ID (NCBI): 1786\nRRID: AB_3670526\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P26358\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888419917993,"sku":"82678-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-82678-2-rr","provider":"Iright","version":"1.0","type":"link"}