{"product_id":"proteintech-82702-1-rr","title":"Proteintech, 82702-1-RR, CHCHD2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CHCHD2 (82702-1-RR) by Proteintech is a Recombinant antibody targeting CHCHD2 in WB, IF\/ICC, ELISA applications with reactivity to human, rat samples\n82702-1-RR targets CHCHD2 in WB, IF\/ICC, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, LNCaP cells,  Jurkat cells,  K-562 cells,  HSC-T6 cells\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCHCHD2 is a widely expressed 16.7-kDa mitochondrion-localized protein. CHCHD2 contains a C-terminal CHCH (coiled-coil helix coiled-coil helix) domain. Mutations in CHCHD2 gene have been reported in autosomal dominant Parkinson's disease (ADPD). CHCHD2 is a bi-organellar mediator of oxidative phosphorylation, playing crucial roles in regulating electron flow in the mitochondrial electron transport chain and acting as a nuclear transcription factor for a cytochrome c oxidase subunit (COX4I2) and itself in response to hypoxic stress. CHCHD2 also regulates cell migration and differentiation, mitochondrial cristae structure, and apoptosis (PMID: 33967741).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag13752 Product name: Recombinant human CHCHD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-151 aa of BC003079 Sequence: MPRGSRSRTSRMAPPASRAPQMRAAPRPAPVAQPPAAAPPSAVGSSAAAPRQPGLMAQMATTAAGVAVGSAVGHTLGHAITGGFSGGSNAEPARPDITYQEPQGTQPAQQQQPCLYEIKQFLECAQNQGDIKLCEGFNEVLKQCRLANGLA Predict reactive species\nFull Name: coiled-coil-helix-coiled-coil-helix domain containing 2\nCalculated Molecular Weight: 151 aa, 16 kDa\nObserved Molecular Weight: 16 kDa\nGenBank Accession Number: BC003079\nGene Symbol: CHCHD2\nGene ID (NCBI): 51142\nRRID: AB_3086512\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9Y6H1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888352678057,"sku":"82702-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-82702-1-rr","provider":"Iright","version":"1.0","type":"link"}