{"product_id":"proteintech-82781-6-rr","title":"Proteintech, 82781-6-RR, CD55 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CD55 (82781-6-RR) by Proteintech is a Recombinant antibody targeting CD55 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n82781-6-RR targets CD55 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A549 cells,  MKN-45 cells,  human placenta tissue,  K-562 cells\nPositive IHC detected in: human lung cancer tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD55, also known as DAF, is a glycosylphosphatidylinositol (GPI)-anchored surface glycoprotein that is widely distributed on blood, stroma, epithelial, and endothelial cells (PMID: 7517044; 29503741). It can also exist as a soluble form in plasma, urine, saliva, tears, and synovial fluids (PMID: 29503741). CD55 is a complement regulatory protein (PMID: 2469439; 7517044). It inhibits formation of the C3 convertases through binding to C3b and C4b. It also binds the alternate pathway convertase C3bBb, the classical pathway convertase and C4b2a to accelerate their decay (PMID: 17289551). CD55 also serves as a receptor for coxsackieviruses B1, B3, and B5 and several enteroviruses (PMID: 7538177; 7517044). The observed molecular weight of mature CD55 varies between 50 to 100 kDa depending on the cell type. Different sizes of CD55 might be caused by alternative splicing or different glycosylation patterns (PMID: 29503741).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag25026 Product name: Recombinant human CD55 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 35-126 aa of BC001288 Sequence: DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVE Predict reactive species\nFull Name: CD55 molecule, decay accelerating factor for complement (Cromer blood group)\nCalculated Molecular Weight: 41 kDa\nObserved Molecular Weight: 75 kDa\nGenBank Accession Number: BC001288\nGene Symbol: CD55\nGene ID (NCBI): 1604\nRRID: AB_3086534\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P08174\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888402649257,"sku":"82781-6-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-82781-6-rr","provider":"Iright","version":"1.0","type":"link"}