{"product_id":"proteintech-82872-1-rr","title":"Proteintech, 82872-1-RR, NOX2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe NOX2 (82872-1-RR) by Proteintech is a Recombinant antibody targeting NOX2 in IF-P, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n82872-1-RR targets NOX2 in WB, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF-P detected in: mouse spleen tissue\nPositive FC (Intra) detected in: RAW 264.7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)-P: IF-P : 1:1000-1:4000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNOX2, also named as CYBB, CGD, 91-phox, gp91-1, gp91-phox, p22 phagocyte B-cytochrome, cytochrome b-245 and beta polypeptide, is a critical component of the membrane-bound oxidase of phagocytes that generates superoxide. It is the terminal component of a respiratory chain that transfers single electrons from cytoplasmic NADPH across the plasma membrane to molecular oxygen on the exterior. This full length protein has three glycosylation sites. CYBB is found in human cardiomyocytes as multiple bands:the signal between 55 and 65 kDa is probably the unglycosylated protein, because the predicted molecular weight of unglycosylated CYBB protein is approximately 58 kDa(PMID: 17587483) to 65 kDa in phagocytes and the bands around 80 kDa probably represent glycosylated CYBB, as has also been shown in human umbilical vein endothelial cells(PMID:12610097). In other reports, it also can be detected a band of 91 kDa(PMID:19965781).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag4402 Product name: Recombinant human CYBB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 418-570 aa of BC032720 Sequence: SILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF Predict reactive species\nFull Name: cytochrome b-245, beta polypeptide\nCalculated Molecular Weight: 577 aa, 65 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC032720\nGene Symbol: NOX2\nGene ID (NCBI): 1536\nRRID: AB_3670592\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P04839\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888375156905,"sku":"82872-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-82872-1-rr","provider":"Iright","version":"1.0","type":"link"}