{"product_id":"proteintech-82875-1-rr","title":"Proteintech, 82875-1-RR, SHPK Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SHPK (82875-1-RR) by Proteintech is a Recombinant antibody targeting SHPK in IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n82875-1-RR targets SHPK in IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: Human Hepatocellular cancerNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\nPositive FC (Intra) detected in: U-2 OS\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSHPK, also named CARKL, is a carbohydrate kinase involved in the phosphorylation of sugars as they enter a cell, inhibiting return across the cell membrane (PubMed: 10673275). SHPK is a sedoheptulose kinase of the pentose phosphate pathway. It acts as a modulator of macrophage activation through control of glucose metabolism (PMID: 22682222).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag33893 Product name: Recombinant human SHPK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 65-253 aa of BC020543 Sequence: ILQALHECLAALPRPQLRSVVGIGVSGQMHGVVFWKTGQGCEWTEGGITPVFEPRAVSHLVTWQDGRCSSEFLASLPQPKSHLSVATGFGCATIFWLLKYRPEFLKSYDAAGTIHDYVVAMLCGLPRPLMSDQNAASWGYFNTQSQSWNVETLRSSGFPVHLLPDIAEPGSVAGRTSHMWFEIPKGTQV Predict reactive species\nFull Name: sedoheptulokinase\nCalculated Molecular Weight: 478 aa, 52 kDa\nGenBank Accession Number: BC020543\nGene Symbol: SHPK\nGene ID (NCBI): 23729\nRRID: AB_3670594\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9UHJ6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888865890473,"sku":"82875-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-82875-1-rr","provider":"Iright","version":"1.0","type":"link"}