{"product_id":"proteintech-82883-1-rr","title":"Proteintech, 82883-1-RR, OAS1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe OAS1 (82883-1-RR) by Proteintech is a Recombinant antibody targeting OAS1 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse samples\n82883-1-RR targets OAS1 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A549 cells\nPositive IHC detected in: mouse liver tissue, mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe 2-prime,5-prime oligoadenylate synthetases (OASs), such as OAS1, are interferon-induced proteins characterized by their capacity to catalyze the synthesis of 2-prime,5-prime oligomers of adenosine (2-5As). OAS1 (type I enzymes) has some isoforms with the MW of 40, 42, 44, 46, and 48 kDa (PMID:12590567, 19383565). OAS1 is a strong candidate for determining susceptibility or resistance to viral infections(PMID:15732009).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag6793 Product name: Recombinant human OAS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC000562 Sequence: MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGSYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLVRPPA Predict reactive species\nFull Name: 2',5'-oligoadenylate synthetase 1, 40\/46kDa\nCalculated Molecular Weight: 46 kDa\nObserved Molecular Weight: 38 kDa\nGenBank Accession Number: BC000562\nGene Symbol: OAS1\nGene ID (NCBI): 4938\nRRID: AB_3670601\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P00973\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888350023849,"sku":"82883-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-82883-1-rr","provider":"Iright","version":"1.0","type":"link"}