{"product_id":"proteintech-82928-1-rr","title":"Proteintech, 82928-1-RR, BMPR1A Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe BMPR1A (82928-1-RR) by Proteintech is a Recombinant antibody targeting BMPR1A in WB, FC (Intra), IP, ELISA applications with reactivity to human, mouse samples\n82928-1-RR targets BMPR1A in WB, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, U2OS cells,  HEK-293 cells,  mouse heart tissue\nPositive IP detected in: HEK-293 cells\nPositive FC (Intra) detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBMPR1A (Bone morphogenetic protein receptor type-1A) is also named as ACVRLK3, ALK3 and SKR5. BMPR1A is an essential receptor for BMP signaling (PMID: 26279380). BMPR1A is necessary for chondrogenesis and osteogenesis (PMID: 32764110). BMPR1A is a cell surface marker of human SuSCs (PMID: 33658353).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag3410 Product name: Recombinant human BMPR1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 174-427 aa of BC028383 Sequence: FCYKHYCKSISSRRRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQVGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAHRDLKSKNILIKKNGSCCIADLGLAVKFNSDTNEVDVPLNTRVGTKRYMAPEVLDESLNKNHFQPYIM Predict reactive species\nFull Name: bone morphogenetic protein receptor, type IA\nCalculated Molecular Weight: 532 aa, 60 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: BC028383\nGene Symbol: BMPR1A\nGene ID (NCBI): 657\nRRID: AB_3670667\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P36894\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888351531177,"sku":"82928-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-82928-1-rr","provider":"Iright","version":"1.0","type":"link"}