{"product_id":"proteintech-82950-1-rr","title":"Proteintech, 82950-1-RR, HEBP1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe HEBP1 (82950-1-RR) by Proteintech is a Recombinant antibody targeting HEBP1 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n82950-1-RR targets HEBP1 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A549 cells,  L02 cells,  HepG2 cells,  rat liver tissue. mouse liver tissue\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag10538 Product name: Recombinant human HEBP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-189 aa of BC016277 Sequence: MLGMIKNSLFGSVETWPWQVLSKGDKEEVAYEERACEGGKFATVEVTDKPVDEALREAMPKVAKYAGGTNDKGIGMGMTVPISFAVFPNEDGSLQKKLKVWFRIPNQFQSDPPAPSDKSVKIEEREGITVYSMQFGGYAKEADYVAQATRLRAALEGTATYRGDIYFCTGYDPPMKPYGRRNEIWLLKT Predict reactive species\nFull Name: heme binding protein 1\nCalculated Molecular Weight: 189 aa, 21 kDa\nObserved Molecular Weight: 21 kDa\nGenBank Accession Number: BC016277\nGene Symbol: HEBP1\nGene ID (NCBI): 50865\nRRID: AB_3670693\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9NRV9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888345141417,"sku":"82950-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-82950-1-rr","provider":"Iright","version":"1.0","type":"link"}