{"product_id":"proteintech-82957-1-rr","title":"Proteintech, 82957-1-RR, FDX1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe FDX1 (82957-1-RR) by Proteintech is a Recombinant antibody targeting FDX1 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n82957-1-RR targets FDX1 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, A549 cells,  HepG2 cells,  PC-3 cells,  HK-2 cells\nPositive IHC detected in: human intrahepatic cholangiocarcinoma tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: A431 cells, HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFDX1(Ferredoxin-1) is also named as ADX, FDX, YAH1, LOH11CR1D and belongs to the adrenodoxin\/putidaredoxin family. It is a small iron-sulfur protein that transfers electrons from NADPH through ferredoxin reductase to a terminal cytochrome P450 and it can only reduce mitochondrial CYP enzymes that are essential in adrenal steroidogenesis, bile acid formation, and vitamin D synthesis. The full length has a transit peptide of 60 amino acids.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag3301 Product name: Recombinant human FDX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-184 aa of BC017063 Sequence: MAAAGGARLLRAASAVLGGPAGRWLHHAGSRAGSSGLLRNRGPGGSAEASRSLSVSARARSSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS Predict reactive species\nFull Name: ferredoxin 1\nCalculated Molecular Weight: 184 aa, 19 kDa\nObserved Molecular Weight: 14 kDa\nGenBank Accession Number: BC017063\nGene Symbol: FDX1\nGene ID (NCBI): 2230\nRRID: AB_3670700\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P10109\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888426274985,"sku":"82957-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-82957-1-rr","provider":"Iright","version":"1.0","type":"link"}