{"product_id":"proteintech-82959-1-rr","title":"Proteintech, 82959-1-RR, SCN3B Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SCN3B (82959-1-RR) by Proteintech is a Recombinant antibody targeting SCN3B in WB, ELISA applications with reactivity to human, mouse, rat samples\n82959-1-RR targets SCN3B in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, rat brain tissue,  mouse brain tissue,  fetal human brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe sodium voltage-gated channel beta subunit 3 (SCN3B) plays a crucial role in electrically excitable cells and conduction tissue in the heart. Some previous studies have established that genetic modification in sodium voltage-channel genes encoding for the cardiac β-subunits, such as SCN1B, SCN2B, SCN3B and SCN4B, can result in atrial fibrillation (AF). (PMID: 36362949)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag23201 Product name: Recombinant human SCN3B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-93 aa of BC126265 Sequence: FPVCVEVPSETEAVQGNPMKLRCISCMKREEVEATTVVEWFYRPEGGKDFLIYEYRNGHQEVESPFQGRLQ Predict reactive species\nFull Name: sodium channel, voltage-gated, type III, beta\nObserved Molecular Weight: 29 kDa\nGenBank Accession Number: BC126265\nGene Symbol: SCN3B\nGene ID (NCBI): 55800\nRRID: AB_3670703\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9NY72\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888665186473,"sku":"82959-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-82959-1-rr","provider":"Iright","version":"1.0","type":"link"}