{"product_id":"proteintech-82959-7-rr","title":"Proteintech, 82959-7-RR, SCN3B Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SCN3B (82959-7-RR) by Proteintech is a Recombinant antibody targeting SCN3B in WB, ELISA applications with reactivity to human, mouse, rat samples\n82959-7-RR targets SCN3B in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, rat brain tissue,  mouse brain tissue,  fetal human brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe sodium channel is a multi-subunit protein complex composed of a single large α-subunit along with smaller additional β-subunits. There are at least three different β-subunit genes, SCN1b, SCN2b, and SCN3b, all of which are expressed widely in excitable tissues. The bands on Western blots for SCN3b (45-50 kDa) were significantly larger than the predicted molecular weight, which is consistent with the protein being glycosylated. The two bands on the Western blot could be due to different levels of glycosylation or alternative spliced isoforms. (PMID: 11744748)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag23201 Product name: Recombinant human SCN3B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-93 aa of BC126265 Sequence: FPVCVEVPSETEAVQGNPMKLRCISCMKREEVEATTVVEWFYRPEGGKDFLIYEYRNGHQEVESPFQGRLQ Predict reactive species\nFull Name: sodium channel, voltage-gated, type III, beta\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC126265\nGene Symbol: SCN3B\nGene ID (NCBI): 55800\nRRID: AB_3670704\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q9NY72\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888665120937,"sku":"82959-7-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-82959-7-rr","provider":"Iright","version":"1.0","type":"link"}