{"product_id":"proteintech-82967-1-rr","title":"Proteintech, 82967-1-RR, ACAP1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ACAP1 (82967-1-RR) by Proteintech is a Recombinant antibody targeting ACAP1 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n82967-1-RR targets ACAP1 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, K-562 cells\nPositive IF\/ICC detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nACAP1, also named as Centaurin-beta-1, is a 740 amino acid protein, which is expressed Highly  in lung and spleen. ACAP1 as a GTPase-activating protein (GAP) for ADP ribosylation factor 6 (ARF6) is required for clathrin-dependent export of proteins from recycling endosomes to trans-Golgi network and cell surface and required for regulated export of ITGB1 from recycling endosomes to the cell surface and ITGB1-dependent cell migration.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag34309 Product name: Recombinant human ACAP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 163-270 aa of BC018543 Sequence: RAGYRGRALDYALQINVIEDKRKFDIMEFVLRLVEAQATHFQQGHEELSRLSQYRKELGAQLHQLVLNSAREKRDMEQRHVLLKQKELGGEEPEPSLREGPGGLVMEG Predict reactive species\nFull Name: ArfGAP with coiled-coil, ankyrin repeat and PH domains 1\nCalculated Molecular Weight: 740 aa, 82 kDa\nObserved Molecular Weight: 82-85 kDa\nGenBank Accession Number: BC018543\nGene Symbol: ACAP1\nGene ID (NCBI): 9744\nRRID: AB_3670713\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q15027\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888382103721,"sku":"82967-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-82967-1-rr","provider":"Iright","version":"1.0","type":"link"}