{"product_id":"proteintech-82971-1-rr","title":"Proteintech, 82971-1-RR, GARNL1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe GARNL1 (82971-1-RR) by Proteintech is a Recombinant antibody targeting GARNL1 in WB, FC (Intra), ELISA applications with reactivity to human samples\n82971-1-RR targets GARNL1 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  Jurkat cells\nPositive FC (Intra) detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGARNL1\/RalGAPα1, a major α subunit of the Ral-GTPase activating protein in skeletal muscle, is a protein whose phosphorylation and binding to the regulatory 14-3-3 proteins is stimulated by insulin and also by muscle contraction (PMID:24768767).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag31518 Product name: Recombinant human GARNL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 680-820 aa of NM_014990.3 Sequence: LDLSDLPLDKLSEQKQKKHKGKGVGHEFQKVSVDKSFSRGWSRDQPGQAPMRQRSATTTGSPGTEKARSIVRQKTVDIDDAQILPRSTRVRHFSQSEETGNEVFGALNEEQPLPRSSSTSDILEPFTVERAKVNKEDMSQK Predict reactive species\nFull Name: GTPase activating Rap\/RanGAP domain-like 1\nCalculated Molecular Weight: 230KD\nObserved Molecular Weight: 260 kDa\nGenBank Accession Number: NM_014990.3\nGene Symbol: GARNL1\nGene ID (NCBI): 253959\nRRID: AB_3670719\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q6GYQ0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888427356329,"sku":"82971-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-82971-1-rr","provider":"Iright","version":"1.0","type":"link"}