{"product_id":"proteintech-82974-1-rr","title":"Proteintech, 82974-1-RR, AIFM2\/ FSP1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe AIFM2\/ FSP1 (82974-1-RR) by Proteintech is a Recombinant antibody targeting AIFM2\/ FSP1 in WB, FC (Intra), IP, ELISA applications with reactivity to human samples\n82974-1-RR targets AIFM2\/ FSP1 in WB, FC (Intra), IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells\nPositive IP detected in: HepG2 cells\nPositive FC (Intra) detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe human AIFM2 protein (also known as FSP1 or AMID) is an apoptosis associated flavoprotein with a 6-hydroxy FAD cofactor. AIFM2 is a NAD(P)H-binding oxidoreductase with some sequence similarities to A1FM1 (formerly known as AIF, Apoptosis Inducing Factor), a mitochondrion-associated enzyme which relocates to the cell nucleus during apoptosis and is considered to be a key player in the progression of cell death.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag13412 Product name: Recombinant human AIFM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-373 aa of BC023601 Sequence: MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPP Predict reactive species\nFull Name: apoptosis-inducing factor, mitochondrion-associated, 2\nCalculated Molecular Weight: 41 kDa\nObserved Molecular Weight: 41 kDa\nGenBank Accession Number: BC023601\nGene Symbol: AIFM2\/ FSP1\nGene ID (NCBI): 84883\nRRID: AB_3670722\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9BRQ8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888351006889,"sku":"82974-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-82974-1-rr","provider":"Iright","version":"1.0","type":"link"}