{"product_id":"proteintech-82992-2-rr","title":"Proteintech, 82992-2-RR, LAMP5 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe LAMP5 (82992-2-RR) by Proteintech is a Recombinant antibody targeting LAMP5 in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples\n82992-2-RR targets LAMP5 in WB, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells, U-937 cells\nPositive IF\/ICC detected in: Neuro-2a cells, SH-SY5Y cells\nPositive FC (Intra) detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLAMP5 (Lysosome-associated membrane glycoprotein 5) is also named as BAD-LAMP and C20orf103. BAD-LAMP is a novel biomarker of nonactivated human plasmacytoid dendritic cells (PMID: 21642595). LAMP5 may be one of the key genes in the development of Multiple myeloma (MM) as well as its recurrence  (PMID: 37033323). LAMP5 is a mammalian ortholog of the Caenorhabditis elegans protein, UNC-46, which functions as a sorting factor to localize the vesicular GABA transporter UNC-47 to synaptic vesicles (PMID: 30867010). It was localized exclusively in inhibitory synaptic terminals (PMID: 30867010).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag33894 Product name: Recombinant human LAMP5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-235 aa of BC050727 Sequence: EQEVENLSGLSTNPEKDIFVVRENGTTCLMAEFAAKFIVPYDVWASNYVDLITEQADIALTRGAEVKGRCGHSQSELQVFWVDRAYALKMLFVKESHNMSKGPEATWRLSKVQFVYDSSEKTHFKDAVSAGKHTANSHHLSALVTPAGKSYECQAQQTISLASSDPQKTVTMILSAVHIQPFDIISDFVFSEEHKCPVDEREQLEE Predict reactive species\nFull Name: chromosome 20 open reading frame 103\nObserved Molecular Weight: 31-35 kDa\nGenBank Accession Number: BC050727\nGene Symbol: LAMP5\nGene ID (NCBI): 24141\nRRID: AB_3670740\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9UJQ1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888433156265,"sku":"82992-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-82992-2-rr","provider":"Iright","version":"1.0","type":"link"}