{"product_id":"proteintech-82997-1-rr","title":"Proteintech, 82997-1-RR, FOXO1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe FOXO1 (82997-1-RR) by Proteintech is a Recombinant antibody targeting FOXO1 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples\n82997-1-RR targets FOXO1 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HepG2 cells,  HEK-293 cells,  MCF-7 cells\nPositive IHC detected in: human pancreas cancer tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFOXO1, also named as FOXO1A, FKHR and FKH1, is a member of the FOXO subfamily of Forkhead transcription factors. FOXO1  is a transcription factor which acts as a regulator of cell responses to oxidative stress. FOXO1 interacts with LRPPRC and  SIRT1. In the presence of KIRT1, FOXO1 mediates down-regulation of cyclin D1 and up-regulation of CDKN1B levels which are required for cell transition from proliferative growth to quiescence. FOXO1 contains three predicted protein kinase B phosphorylation sites (Thr-24, Ser-256, and Ser-319) that are conserved in other FOXO proteins. The t(2;13) and the variant t(1;13) translocations generate PAX3\/FKHR and PAX7\/FKHR fusion proteins respectively. The resulting protein is a transcriptional activator. Defects in FOXO1 are a cause of rhabdomyosarcoma type 2 (RMS2).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag13296 Product name: Recombinant human FOXO1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 301-655 aa of BC021981 Sequence: SHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPNYQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG Predict reactive species\nFull Name: forkhead box O1\nCalculated Molecular Weight: 655 aa, 70 kDa\nObserved Molecular Weight: 70-80 kDa\nGenBank Accession Number: BC021981\nGene Symbol: FOXO1\nGene ID (NCBI): 2308\nRRID: AB_3670744\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q12778\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888370208937,"sku":"82997-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-82997-1-rr","provider":"Iright","version":"1.0","type":"link"}