{"product_id":"proteintech-82998-4-rr","title":"Proteintech, 82998-4-RR, CCDC23 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CCDC23 (82998-4-RR) by Proteintech is a Recombinant antibody targeting CCDC23 in IF\/ICC, ELISA applications with reactivity to Human samples\n82998-4-RR targets CCDC23 in IF\/ICC, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCCDC23 also known as SVBP is a small vasohibin-binding protein of 66 amino acids, and functions as a chaperone of VASH1 in vascular endothelial cells(PMID: 20736312). SVBP enhances the tyrosine carboxypeptidase activity of VASH1 and VASH2, thereby promoting the removal of the C-terminal tyrosine residue of alpha-tubulin(PMID: 29146869, 31171830). Mutations in SVBP cause Neurodevelopmental disorders with ataxia, hypotonia, and microcephaly (NEDAHM)(PMID: 30607023, 31363758).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag33650 Product name: Recombinant human CCDC23 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-66 aa of BC029427 Sequence: MDPPARKEKTKVKESVSRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQMQPPGE Predict reactive species\nFull Name: coiled-coil domain containing 23\nGenBank Accession Number: BC029427\nGene Symbol: CCDC23\nGene ID (NCBI): 374969\nRRID: AB_3670745\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8N300\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888853668009,"sku":"82998-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-82998-4-rr","provider":"Iright","version":"1.0","type":"link"}