{"product_id":"proteintech-83020-1-rr","title":"Proteintech, 83020-1-RR, FDFT1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe FDFT1 (83020-1-RR) by Proteintech is a Recombinant antibody targeting FDFT1 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples\n83020-1-RR targets FDFT1 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: L02 cells, T-47D cells,  SH-SY5Y cells,  HepG2 cells,  mouse testis tissue\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: L02 cells, HepG2 cells\nPositive FC (Intra) detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSQS (Squalene synthase), also known as Farnesyl-diphosphate farnesyltransferase 1 (FDFT1) is a gene that encodes the membrane-associated enzyme squalene synthase, which is the first specific enzyme in cholesterol biosynthesis. FDFT1 is highly expressed in liver, lung, prostate, breast, ovary, bladder, cervix, thyroid, and esophageal cancers, while in colorectal, colon, testicular, uterine, pancreas, and kidney tumors, its expression is downregulated (PMID: 35093030). FDFT1 is a key downstream target of the fasting response and may be involved in CRC cell glucose metabolism (PMID: 32313017).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag3743 Product name: Recombinant human SQS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-358 aa of BC029641 Sequence: MEFVKCLGHPEEFYNLVRFRIGGKRKVMPKMDQDSLSSSLKTCYKYLNQTSRSFAAVIQALDGEMRNAVCIFYLVLRALDTLEDDMTISVEKKVPLLHNFHSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICRRMGIGMAEFLDKHVTSEQEWDKYCHYVAGLVGIGLSRLFSASEFEDPLVGEDTERANSMGLFLQKTNIIRDYLEDQQGGREFWPQEVWSRYVKKLGDFAKPENIDLAVQCLNELITNALHHIPDVITYLSRLRNQSVFNFCAIPQVMAIATLAACYNNQQVFKGAVKIRKGQAVTLMMDATNMPAVKAIIYQYMEEIYHRIPDSDPSSSK Predict reactive species\nFull Name: farnesyl-diphosphate farnesyltransferase 1\nCalculated Molecular Weight: 417 aa, 48 kDa\nObserved Molecular Weight: 48 kDa\nGenBank Accession Number: BC029641\nGene Symbol: FDFT1\nGene ID (NCBI): 2222\nRRID: AB_3670761\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P37268\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888751890601,"sku":"83020-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83020-1-rr","provider":"Iright","version":"1.0","type":"link"}