{"product_id":"proteintech-83081-2-rr","title":"Proteintech, 83081-2-RR, STK39 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe STK39 (83081-2-RR) by Proteintech is a Recombinant antibody targeting STK39 in WB, IF\/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n83081-2-RR targets STK39 in WB, IF\/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, HepG2 cells,  MCF-7 cells,  SH-SY5Y cells,  HEK-293T cells,  rat brain tissue\nPositive IF-P detected in: mouse brain tissue\nPositive IF\/ICC detected in: NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSTK39 (Serine\/Threonine Kinase 39) is a proline- and alanine-rich Ste20-related kinase (also named as SPAK), which is composed of a short N-terminal proline and alanine repeats (PAPA box), a kinase catalytic domain and a C-terminal regulatory domain (PMID: 16382158). In mammalians, STK39 plays an important role in ion homeostasis by regulating the cation chloride cotransporters' activities, which is crucial for the modulation of renal salt transport and blood pressure (PMID: 33500714). Notably, STK39 is also implicated in the regulation of tumor cell proliferation, migration, and invasion in multiple cancers, including osteosarcoma and cervical cancer (PMID: 34335956).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag34503 Product name: Recombinant human STK39 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 396-455 aa of BC166614 Sequence: GKAAFSQEKSRRVKEENPEIAVSASTIPEQIQSLSVHDSQGPPNANEDYREASSCAVNLV Predict reactive species\nFull Name: serine threonine kinase 39 (STE20\/SPS1 homolog, yeast)\nCalculated Molecular Weight: 59 kDa\nObserved Molecular Weight: 65 kDa\nGenBank Accession Number: BC166614\nGene Symbol: STK39\nGene ID (NCBI): 27347\nRRID: AB_3670797\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9UEW8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888668266665,"sku":"83081-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83081-2-rr","provider":"Iright","version":"1.0","type":"link"}