{"product_id":"proteintech-83087-2-rr","title":"Proteintech, 83087-2-RR, GDNF Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe GDNF (83087-2-RR) by Proteintech is a Recombinant antibody targeting GDNF in WB, ELISA applications with reactivity to human, mouse samples\n83087-2-RR targets GDNF in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGlial-derived neurotrophic factor (GDNF) is a member of the transforming growth factor (TGF)-α family and exhibits potent neuroprotective activity. GDNF is a potent promoter of neuronal survival in the CNS and peripheral nervous system (PNS). It has a relatively high speciicity for dopaminergic neurons and thus become an efective treatment for Parkinson's diseases (PD), with clinical trials currently in progress.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag24068 Product name: Recombinant human GDNF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 78-211 aa of BC069369 Sequence: SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI Predict reactive species\nFull Name: glial cell derived neurotrophic factor\nCalculated Molecular Weight: 211 aa, 24 kDa\nObserved Molecular Weight: 24-30 kDa\nGenBank Accession Number: BC069369\nGene Symbol: GDNF\nGene ID (NCBI): 2668\nRRID: AB_3670803\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P39905\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888638382249,"sku":"83087-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83087-2-rr","provider":"Iright","version":"1.0","type":"link"}