{"product_id":"proteintech-83096-1-rr","title":"Proteintech, 83096-1-RR, SHBG Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SHBG (83096-1-RR) by Proteintech is a Recombinant antibody targeting SHBG in WB, FC (Intra), ELISA applications with reactivity to human samples\n83096-1-RR targets SHBG in WB, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSHBG (sex hormone-binding globulin), also known as androgen-binding protein (ABP), is the specific transport protein for sex steroid hormones in humans. SHBG is synthesized mainly by the liver and circulates in the blood, in form of homodimer with a single steroid-binding site per dimer. In addition to the plasma SHBG, a testis isoform expressed by Sortoli cells also exists due to the gene alternative splicing. Various bands (44-56 kDa) recognized by this antibody may represent variably glycosylated or different isoforms of SHBG.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg0369 Product name: Recombinant Human SHBG protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 30-402 aa of BC101785 Sequence: LRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRDIPQPHAEPWAFSLDLGLKQAAGSGHLLALGTPENPSWLSLHLQDQKVVLSSGSGPGLDLPLVLGLPLQLKLSMSRVVLSQGSKMKALALPPLGLAPLLNLWAKPQGRLFLGALPGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH Predict reactive species\nFull Name: sex hormone-binding globulin\nCalculated Molecular Weight: 402 aa, 44 kDa\nObserved Molecular Weight: 40-50 kDa\nGenBank Accession Number: BC101785\nGene Symbol: SHBG\nGene ID (NCBI): 6462\nRRID: AB_3670810\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P04278\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888443052201,"sku":"83096-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83096-1-rr","provider":"Iright","version":"1.0","type":"link"}