{"product_id":"proteintech-83100-1-rr","title":"Proteintech, 83100-1-RR, PCYT1A Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe PCYT1A (83100-1-RR) by Proteintech is a Recombinant antibody targeting PCYT1A in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples\n83100-1-RR targets PCYT1A in WB, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, NIH\/3T3 cells,  mouse testis tissue,  mouse brain tissue\nPositive IF\/ICC detected in: MCF-7 cells\nPositive FC (Intra) detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag34268 Product name: Recombinant human PCYT1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-76 aa of NM_005017 Sequence: MDAQCSAKVNARKRRKEAPGPNGATEEDGVPSKVQRCAVGLRQPAPFSDEIEVDFSKPYVRVTMEEASRGTPCERP Predict reactive species\nFull Name: phosphate cytidylyltransferase 1, choline, alpha\nCalculated Molecular Weight: 42 kDa\nObserved Molecular Weight: 38-41 kDa\nGenBank Accession Number: NM_005017\nGene Symbol: PCYT1A\nGene ID (NCBI): 5130\nRRID: AB_3670813\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P49585\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888438366377,"sku":"83100-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83100-1-rr","provider":"Iright","version":"1.0","type":"link"}