{"product_id":"proteintech-83151-5-rr","title":"Proteintech, 83151-5-RR, TIMP1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe TIMP1 (83151-5-RR) by Proteintech is a Recombinant antibody targeting TIMP1 in IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n83151-5-RR targets TIMP1 in IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: HT-29 cells, MDA-MB-231 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTIMP1 is a member of the family of matrix metalloproteinase inhibitors, which contains four members (TIMP1, TIMP2, TIMP3, and TIMP4). Tissue inhibitors of metalloproteinases (TIMPs) are multifaceted molecules that exhibit properties beyond their classical proteinase inhibitory function. TIMP1 has several MMP-independent functions such as modulation of angiogenesis, promotion of cell proliferation, and inhibition of apoptosis. TIMP1 plays important role in cell cycle regulation and cancer progression. Recently, clinical studies have shown that the aberrant expression of TIMP1 is associated with an unfavorable prognosis in a series of tumors, such as gastric cancer, papillary thyroid carcinoma, cutaneous melanoma and breast cancer. In pregnancy, TIMP1 plays a regulatory role in the process of implantation, particularly the cytotrophoblast invasion of the uterine endometrium. In pregnancy, TIMP1 plays a regulatory role in the process of implantation, particularly the cytotrophoblast invasion of the uterine endometrium.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg0638 Product name: Recombinant human TIMP1 protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 24-207 aa of BC000866 Sequence: CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA Predict reactive species\nFull Name: TIMP metallopeptidase inhibitor 1\nCalculated Molecular Weight: 23 kDa\nGenBank Accession Number: BC000866\nGene Symbol: TIMP1\nGene ID (NCBI): 7076\nRRID: AB_3670846\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P01033\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888867004585,"sku":"83151-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83151-5-rr","provider":"Iright","version":"1.0","type":"link"}