{"product_id":"proteintech-83155-4-rr","title":"Proteintech, 83155-4-RR, HOXB6 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe HOXB6 (83155-4-RR) by Proteintech is a Recombinant antibody targeting HOXB6 in IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n83155-4-RR targets HOXB6 in IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF\/ICC detected in: HepG2 cells, A431 cells\nPositive FC (Intra) detected in: K562\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:150-1:600\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHOXB6 is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development, including that of lung and skin, and has been localized to both the nucleus and cytoplasm. Altered expression of this gene or a change in the subcellular localization of its protein is associated with some cases of acute myeloid leukemia and colorectal cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag14189 Product name: Recombinant human HOXB6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-160 aa of BC014651 Sequence: MSSYFVNSTFPVTLASGQESFLGQLPLYSSGYADPLRHYPAPYGPGPGQDKGFATSSYYPPAGGGYGRAAPCDYGPAPAFYREKESACALSGADEQPPFHPEPRKSDCAQDKSVFGETEEQKCSTPVYPWMQRMNSCNSSSFGPSGRRGRQTYTRYQTLE Predict reactive species\nFull Name: homeobox B6\nCalculated Molecular Weight: 224 aa, 25 kDa\nGenBank Accession Number: BC014651\nGene Symbol: HOXB6\nGene ID (NCBI): 3216\nRRID: AB_3670849\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P17509\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888859435177,"sku":"83155-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83155-4-rr","provider":"Iright","version":"1.0","type":"link"}