{"product_id":"proteintech-83175-2-rr","title":"Proteintech, 83175-2-RR, TRIM54 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe TRIM54 (83175-2-RR) by Proteintech is a Recombinant antibody targeting TRIM54 in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples\n83175-2-RR targets TRIM54 in WB, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human heart tissue, mouse heart tissue\nPositive IF\/ICC detected in: C2C12 cells, HepG2 cells\nPositive FC (Intra) detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:14000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTRIM54 (Tripartite motif-containing protein 54) is also names as MURF, MURF3, RNF30. The expression of TRIM54 is required for skeletal myoblast differentiation and myotube fusion. It is expressed in heart and skeletal muscle specifically (PMID:11243782). It has two isoforms with the molecular weight of 40KDa and 45KDa. It can be dimerizated and hetero-dimerizated to form homooligomer and heterooligomer (PMID:15967462).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag15229 Product name: Recombinant human TRIM54 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 178-358 aa of BC141807 Sequence: IAMLVAGNDRVQAVITQMEEVCQTIEDNSRRQKQLLNQRFESLCAVLEERKGELLQALAREQEEKLQRVRGLIRQYGDHLEASSKLVESAIQSMEEPQMALYLQQAKELINKVGAMSKVELAGRPEPGYESMEQFTVRVEHVAEMLRTIDFQPGASGEEEEVAPDGEEGSAGPEEERPDGP Predict reactive species\nFull Name: tripartite motif-containing 54\nCalculated Molecular Weight: 358 aa, 40 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC141807\nGene Symbol: TRIM54\nGene ID (NCBI): 57159\nRRID: AB_3670869\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9BYV2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888521302185,"sku":"83175-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83175-2-rr","provider":"Iright","version":"1.0","type":"link"}