{"product_id":"proteintech-83189-3-rr","title":"Proteintech, 83189-3-RR, SORBS2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SORBS2 (83189-3-RR) by Proteintech is a Recombinant antibody targeting SORBS2 in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n83189-3-RR targets SORBS2 in WB, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: L02 cells, HuH-7 cells\nPositive IF\/ICC detected in: U2OS cells\nPositive FC (Intra) detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSORBS2, also known as ARGBP2, has three C-terminal SH3 domains and an N-terminal sorbin homology (SoHo) domain that interacts with lipid raft proteins. SORBS2 is widely expressed in human tissues and extremely abundant in the heart. In epithelial cells SORBS2 is located in stress fibers and the nucleus; In cardiac muscle cells. SORBS2 is located in the Z-disks of sarcomeres. The subcellular localization suggests that SORBS2 functions as an adapter protein to assemble signaling complexes in stress fibers, and may influence the contractile or elastic properties of cardiac sarcomeres(PMID: 9211900). Alternate splicing results in multiple transcript variants( PMID: 28961272).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag20041 Product name: Recombinant human SORBS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-198 aa of BC011883 Sequence: MSYYQRPFSPSAYSLPASLNSSIVMQHGTSLDSTDTYPQHAQSLDGTTSSSIPLYRSSEEEKRVTVIKAPHYPGIGPVDESGIPTAIRTTVDRPKDWYKTMFKQIHMVHKPDDDTDMYNTPYTYNAGLYNPPYSAQSHPAAKTQTYRPLSKSHSDNSPNAFKDASSPVPPPHVPPPVPPLRPRDRSSTEKHDWDPPDR Predict reactive species\nFull Name: sorbin and SH3 domain containing 2\nCalculated Molecular Weight: 1100 aa, 124 kDa\nObserved Molecular Weight: 70-75 kDa\nGenBank Accession Number: BC011883\nGene Symbol: SORBS2\nGene ID (NCBI): 8470\nRRID: AB_3670879\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: O94875\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888378990761,"sku":"83189-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83189-3-rr","provider":"Iright","version":"1.0","type":"link"}