{"product_id":"proteintech-83192-1-rr","title":"Proteintech, 83192-1-RR, SLC22A4 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SLC22A4 (83192-1-RR) by Proteintech is a Recombinant antibody targeting SLC22A4 in WB, ELISA applications with reactivity to human, mouse samples\n83192-1-RR targets SLC22A4 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, mouse kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC22A4 (solute carrier family 22 member 4), also known as OCTN1. It is expected to be located in cell membrane and mitochondrion membrane. It is strongly expressed in kidney, trachea, bone marrow and fetal liver and in several human cancer cell lines, but not in adult liver (PMID: 9426230). The protein functions as a Na+-dependent and pH-dependent high affinity microbial symporter of potent food-derived antioxidant ergothioeine (PubMed:15795384), which  transports one sodium ion with one ergothioeine molecule.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag3974 Product name: Recombinant human SLC22A4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 32-142 aa of BC028313 Sequence: NGFNGMSVVFLAGTPEHRCRVPDAANLSSAWRNNSVPLRLRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTVVTEWNLVCEDNWKV Predict reactive species\nFull Name: solute carrier family 22 (organic cation\/ergothioneine transporter), member 4\nCalculated Molecular Weight: 551 aa, 62 kDa\nObserved Molecular Weight: 62-65 kDa\nGenBank Accession Number: BC028313\nGene Symbol: SLC22A4\nGene ID (NCBI): 6583\nRRID: AB_3670882\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9H015\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888666726569,"sku":"83192-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83192-1-rr","provider":"Iright","version":"1.0","type":"link"}