{"product_id":"proteintech-83216-3-rr","title":"Proteintech, 83216-3-RR, NDUFB8 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe NDUFB8 (83216-3-RR) by Proteintech is a Recombinant antibody targeting NDUFB8 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n83216-3-RR targets NDUFB8 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, A549 cells,  mouse liver tissue,  mouse brain tissue,  rat brain tissue,  HeLa cells,  Jurkat cells\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human stomach cancer tissue, human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag6495 Product name: Recombinant human NDUFB8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-186 aa of BC000466 Sequence: MAVARAGVLGVQWLQRASRNVMPLGARTASHMTKDMFPGPYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQHERDPWYSWDQPGLRLNWGEPMHWHLDMYNRNRVDTSPTPVSWHVMCMQLFGFLAFMIFMCWVGDVYPVYQPVGPKQYPYNNLYLERGGDPSKEPERVVHYEI Predict reactive species\nFull Name: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa\nCalculated Molecular Weight: 22 kDa\nObserved Molecular Weight: 19-22 kDa\nGenBank Accession Number: BC000466\nGene Symbol: NDUFB8\nGene ID (NCBI): 4714\nRRID: AB_3670901\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: O95169\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888349794473,"sku":"83216-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83216-3-rr","provider":"Iright","version":"1.0","type":"link"}