{"product_id":"proteintech-83245-1-rr","title":"Proteintech, 83245-1-RR, Cxcl15 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Cxcl15 (83245-1-RR) by Proteintech is a Recombinant antibody targeting Cxcl15 in WB, ELISA applications with reactivity to mouse samples\n83245-1-RR targets Cxcl15 in WB, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse lung tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCxcl15, also known as lungkine or WECHE, is a small cytokine belonging to the CXC chemokine family that has been described in the mouse. High levels of Cxcl15 mRNA were specifically detected in the lung and at lower levels in fetal lung tissue by Northern blot and in situ hybridization, suggesting a potential role for this chemokine during lung development. Moreover, the Cxcl15 protein is secreted into the airway spaces and induces the in vitro and in vivo migration of neutrophils, suggesting that it is involved in lung-specific neutrophil trafficking.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag33964 Product name: Recombinant mouse Cxcl15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 26-127 aa of BC061138 Sequence: QELRCLCIQEHSEFIPLKLIKNIMVIFETIYCNRKEVIAVPKNGSMICLDPDAPWVKATVGPITNRFLPEDLKQKEFPPAMKLLYSVEHEKPLYLSFGRPENKRIFPFPIRETSRHFADLAHNSDRNFLRDSSEVSLTGSDA Predict reactive species\nFull Name: chemokine (C-X-C motif) ligand 15\nCalculated Molecular Weight: 19 kDa\nObserved Molecular Weight: 19 kDa\nGenBank Accession Number: BC061138\nGene Symbol: Cxcl15\nGene ID (NCBI): 20309\nRRID: AB_3670920\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9WVL7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888608923817,"sku":"83245-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83245-1-rr","provider":"Iright","version":"1.0","type":"link"}