{"product_id":"proteintech-83251-2-rr","title":"Proteintech, 83251-2-RR, NRG1, isoform Alpha Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe NRG1, isoform Alpha (83251-2-RR) by Proteintech is a Recombinant antibody targeting NRG1, isoform Alpha in IF\/ICC, IF-P, ELISA applications with reactivity to human samples\n83251-2-RR targets NRG1, isoform Alpha in IF\/ICC, IF-P, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF-P detected in: rat brain tissue\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)-P: IF-P : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNeuregulin 1 (NRG1) is a trophic factor that has been implicated in neural development, neurotransmission, and synaptic plasticity. NRG1 has multiple isoforms that are generated by usage of different promoters and alternative splicing of a single gene. NRG1 and its receptor ErbB tyrosine kinase are expressed not only in the developing nervous system, but also in the adult brain. The immunogen of this antibody is against NRG1 isoform Alpha.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag35114 Product name: Recombinant human NRG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 177-241 aa of BC007675 Sequence: SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCQPGFTGARCTENVPMKVQNQEKAEELYQK Predict reactive species\nFull Name: neuregulin 1\nCalculated Molecular Weight: 70 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC007675\nGene Symbol: NRG1\nGene ID (NCBI): 3084\nRRID: AB_3670926\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q02297\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888862941353,"sku":"83251-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83251-2-rr","provider":"Iright","version":"1.0","type":"link"}