{"product_id":"proteintech-83264-6-rr","title":"Proteintech, 83264-6-RR, EFHD2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe EFHD2 (83264-6-RR) by Proteintech is a Recombinant antibody targeting EFHD2 in WB, FC (Intra), ELISA applications with reactivity to human, mouse samples\n83264-6-RR targets EFHD2 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HuH-7 cells, NK-92 cells,  A549 cells,  NCI-H1299 cells,  mouse brain tissue\nPositive FC (Intra) detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEFHD2 also named Swiprosin-1, is a Ca2+ binding actin protein. The expression of EFHD2 is upregulated during the activation of immune cells, epithelial and endothelial cells. The expression of EFHD2 is regulated by diverse signaling pathways that are contingent upon the specific type of cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag35084 Product name: Recombinant human EFHD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-80 aa of BC023611 Sequence: ATDELATKLSRRLQMEGEGGGETPEQPGLNGAAAAAAGAPDEAAEALGSADCELSAKLLRRADLNQGIGEPQSPSRRVF Predict reactive species\nFull Name: EF-hand domain family, member D2\nCalculated Molecular Weight: 27 kDa\nObserved Molecular Weight: 27 kDa\nGenBank Accession Number: BC023611\nGene Symbol: EFHD2\nGene ID (NCBI): 79180\nRRID: AB_3670936\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q96C19\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888612200617,"sku":"83264-6-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83264-6-rr","provider":"Iright","version":"1.0","type":"link"}