{"product_id":"proteintech-83281-3-rr","title":"Proteintech, 83281-3-RR, NOD2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe NOD2 (83281-3-RR) by Proteintech is a Recombinant antibody targeting NOD2 in IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n83281-3-RR targets NOD2 in IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNOD2, also named as CARD15 and IBD1, induces NF-kappa-B via RICK (CARDIAK, RIP2) and IKK-gamma. It confers responsiveness to intracellular bacterial lipopolysaccharides (LPS). Defects in NOD2 are the cause of Blau syndrome (BS). Defects in NOD2 are a cause of susceptibility to Crohn disease (CD). Defects in NOD2 are a cause of susceptibility to ulcerative colitis. Defects in NOD2 are the cause of early-onset sarcoidosis (EOS).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag33771 Product name: Recombinant human NOD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-216 aa of NM_001293557 Sequence: SQEAFQAQRSQLVELLVSGSLEGFESVLDWLLSWEVLSWEDYEGFHLLGQPLSHLARRLLDTVWNKGTWACQKLIAAAQEAQADSQSPKLHGCWDPHSLHPARDLQSHRPAIVRRLHSHVENMLDLAWERGFVSQYECDEIRLPIFTPSQRARRLLDLATVKANGLAAFLLQHVQELPVPLALPLEA* Predict reactive species\nFull Name: nucleotide-binding oligomerization domain containing 2\nCalculated Molecular Weight: 115 kDa\nGenBank Accession Number: NM_001293557\nGene Symbol: NOD2\nGene ID (NCBI): 64127\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9HC29\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888791212201,"sku":"83281-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83281-3-rr","provider":"Iright","version":"1.0","type":"link"}