{"product_id":"proteintech-83296-4-rr","title":"Proteintech, 83296-4-RR, FGD6 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe FGD6 (83296-4-RR) by Proteintech is a Recombinant antibody targeting FGD6 in WB, ELISA applications with reactivity to human samples\n83296-4-RR targets FGD6 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, A549 cells,  Jurkat cells,  HeLa cells,  HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFGD6, also known as ZFYVE24, is localized on the Homo sapiens chromosome 12q22 and consists of 1,400 amino acids. Previous studies have reported that variations in FGD6 increase individual susceptibility to polypoidal choroidal vasculopathy. It was also demonstrated that FGD6 coordinates cell polarity and endosomal membrane recycling in osteoclasts by regulating the assembly of different actin-based protein networks and activating Cdc42 at different locations.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag22211 Product name: Recombinant human FGD6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 289-348 aa of BC013319 Sequence: ACSSNKYGLDYLKNQPARVCEHCFQELQKLDHQHSPRIGSPGNHKSPSSALSSVLHSIPS Predict reactive species\nFull Name: FYVE, RhoGEF and PH domain containing 6\nCalculated Molecular Weight: 1430 aa, 161 kDa\nObserved Molecular Weight: 161 kDa\nGenBank Accession Number: BC013319\nGene Symbol: FGD6\nGene ID (NCBI): 55785\nRRID: AB_3670963\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q6ZV73\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888636514473,"sku":"83296-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83296-4-rr","provider":"Iright","version":"1.0","type":"link"}