{"product_id":"proteintech-83302-1-rr","title":"Proteintech, 83302-1-RR, PGT Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe PGT (83302-1-RR) by Proteintech is a Recombinant antibody targeting PGT in WB, FC (Intra), ELISA applications with reactivity to human, mouse samples\n83302-1-RR targets PGT in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NIH\/3T3 cells, mouse heart tissue\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProstaglandin transporter (PGT), also known as SLCO2A1, has been identified as a functional prostaglandin (PG) carrier that mediates either the release of newly-synthesized PGs by cells and\/or the uptake of PGs prior to intracellular oxidation. Northern blot analysis revealed that PGT mRNA has broad tissue distribution, suggesting its role in the transport and\/ or metabolic clearance of PG in diverse tissues (PMID: 8787677,22331663).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag5594 Product name: Recombinant human PGT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 422-643 aa of BC041140 Sequence: TPTVAEVYPPSTSSSIHPQSPACRRDCSCPDSIFHPVCGDNGIEYLSPCHAGCSNINMSSATSKQLIYLNCSCVTGGSASAKTGSCPVPCAHFLLPAIFLISFVSLIACISHNPLYMMVLRVVNQEEKSFAIGVQFLLMRLLAWLPSPALYGLTIDHSCIRWNSLCLGRRGACAYYDNDALRDRYLGLQMGYKALGMLLLCFISWRVKKNKEYNVQKAAGLI Predict reactive species\nFull Name: solute carrier organic anion transporter family, member 2A1\nCalculated Molecular Weight: 70 kDa\nObserved Molecular Weight: 65 kDa\nGenBank Accession Number: BC041140\nGene Symbol: PGT\nGene ID (NCBI): 6578\nRRID: AB_3670971\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q92959\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888438825129,"sku":"83302-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83302-1-rr","provider":"Iright","version":"1.0","type":"link"}