{"product_id":"proteintech-83304-1-rr","title":"Proteintech, 83304-1-RR, GGT1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe GGT1 (83304-1-RR) by Proteintech is a Recombinant antibody targeting GGT1 in WB, IHC, ELISA applications with reactivity to human samples\n83304-1-RR targets GGT1 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human kidney tissue\nPositive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGGT1 is a transpeptidase whose activity increases the availability of amino acids, primarily cysteine, for intracellular GSH synthesis. GGT1 also plays a critical role in maintaining GSH homeostasis and defense against oxidative stress. In liver and obstructive biliary diseases, circulating GGT1 activity has widely been used for diagnosis purposes, as well as an indicator of alcohol consumption. (PMID: 31151999)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag34209 Product name: Recombinant human GGT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 381-470 aa of NM_013430 Sequence: TAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVG Predict reactive species\nFull Name: gamma-glutamyltransferase 1\nCalculated Molecular Weight: 61 kDa\nObserved Molecular Weight: 24 kDa\nGenBank Accession Number: NM_013430\nGene Symbol: GGT1\nGene ID (NCBI): 2678\nRRID: AB_3670973\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P19440\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888638447785,"sku":"83304-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83304-1-rr","provider":"Iright","version":"1.0","type":"link"}