{"product_id":"proteintech-83309-1-rr","title":"Proteintech, 83309-1-RR, BCDIN3D Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe BCDIN3D (83309-1-RR) by Proteintech is a Recombinant antibody targeting BCDIN3D in WB, ELISA applications with reactivity to human samples\n83309-1-RR targets BCDIN3D in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, SH-SY5Y cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBCDIN3D (BCDIN3 domain containing RNA methyltransferase), it is expected to be located in cytoplasm, which is ubiquitous expressed in prostate, lymph node and skeletal muscle. This gene encodes an RNA methyltransferase which belongs to the rossmann fold methyltransferase family and serves as a 5'-methylphosphate capping enzyme that is specific for cytoplasmic histidyl tRNA. The encoded protein contains an S-adenosylmethionine binding domain and uses the methyl group donor, S-adenosylmethionine. This gene is overexpressed in breast cancer cells, and is related to the tumorigenic phenotype and poor prognosis of breast cancer. The encoded protein is thought to promote the cellular invasion of breast cancer cells, by downregulating the expression of tumor suppressor miRNAs through the dimethylation of the 5-monophosphate of the corresponding precursor miRNAs. The molecular weight of BCDIN3D is 33 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag15613 Product name: Recombinant human BCDIN3D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-292 aa of BC053560 Sequence: MAVPTELDGGSVKETAAEEESRVLAPGAAPFGNFPHYSRFHPPEQRLRLLPPELLRQLFPESPENGPILGLDVGCNSGDLSVALYKHFLSLPDGETCSDASREFRLLCCDIDPVLVKRAEKECPFPDALTFITLDFMNQRTRKVLLSSFLSQFGRSVFDIGFCMSITMWIHLNHGDHGLWEFLAHLSSLCHYLLVEPQPWKCYRAAARRLRKLGLHDFDHFHSLAIRGDMPNQIVQILTQDHGMELICCFGNTSWDRSLLLFRAKQTIETHPIPESLIEKGKEKNRLSFQKQ Predict reactive species\nFull Name: BCDIN3 domain containing\nCalculated Molecular Weight: 292 aa, 33 kDa\nObserved Molecular Weight: 33 kDa\nGenBank Accession Number: BC053560\nGene Symbol: BCDIN3D\nGene ID (NCBI): 144233\nRRID: AB_3670975\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q7Z5W3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888590901417,"sku":"83309-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83309-1-rr","provider":"Iright","version":"1.0","type":"link"}