{"product_id":"proteintech-83349-3-rr","title":"Proteintech, 83349-3-RR, AGPAT2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe AGPAT2 (83349-3-RR) by Proteintech is a Recombinant antibody targeting AGPAT2 in WB, IHC, FC (Intra), ELISA applications with reactivity to human samples\n83349-3-RR targets AGPAT2 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells,  THP-1 cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\n1-acyl-sn-glycerol-3-phosphate acyltransferase beta (AGPAT2)  belongs to a family of enzymes catalyzing the sn-2 acylation of the glycerol-3-phosphate backbone. AGPAT2 is highly expressed in adipose tissues, liver, and skeletal muscle. AGPAT2 is the only AGPAT isoform whose loss-of-function mutations cause a severe form of human congenital generalized lipodystrophy (PMID: 34824276). Human and mouse AGPAT2 have a calculated molecular mass of 31 kDa, and an alternatively spliced form of AGPAT2 mRNA, encoding a protein of 246 rather than 278 amino acids, is also found in human (PMID: 19336658). Western detected AGPAT2 at an apparent molecular mass of 27 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag34761 Product name: Recombinant human AGPAT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 201-279 aa of BC019292 Sequence: VPVVYSSFSSFYNTKKKFFTSGTVTVQVLEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSGVQPAQ Predict reactive species\nFull Name: 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta)\nCalculated Molecular Weight: 31 kDa\nObserved Molecular Weight: 27 kDa\nGenBank Accession Number: BC019292\nGene Symbol: AGPAT2\nGene ID (NCBI): 10555\nRRID: AB_3671007\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O15120\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888384430249,"sku":"83349-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83349-3-rr","provider":"Iright","version":"1.0","type":"link"}