{"product_id":"proteintech-83352-1-rr","title":"Proteintech, 83352-1-RR, FGR Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe FGR (83352-1-RR) by Proteintech is a Recombinant antibody targeting FGR in WB, IF\/ICC, ELISA applications with reactivity to human samples\n83352-1-RR targets FGR in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Daudi cells, Raji cells\nPositive IF\/ICC detected in: Raji cells\nPositive FC (Intra) detected in: Raji cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFGR (Tyrosine-protein kinase Fgr) is a member of the Src family of protein tyrosine kinases (PTKs). It's contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag34944 Product name: Recombinant human FGR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-90 aa of NM_005248 Sequence: MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQAINPGFLDSGTIRGVSGIGVTLFIALYDYEA Predict reactive species\nFull Name: Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog\nCalculated Molecular Weight: 59 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: NM_005248\nGene Symbol: FGR\nGene ID (NCBI): 2268\nRRID: AB_3671010\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P09769\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888426602665,"sku":"83352-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83352-1-rr","provider":"Iright","version":"1.0","type":"link"}