{"product_id":"proteintech-83360-2-rr","title":"Proteintech, 83360-2-RR, SLC25A46 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SLC25A46 (83360-2-RR) by Proteintech is a Recombinant antibody targeting SLC25A46 in WB, FC (Intra), ELISA applications with reactivity to human, mouse samples\n83360-2-RR targets SLC25A46 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HepG2 cells,  MCF-7 cells,  HeLa cells,  Jurkat cells,  MDA-MB-231 cells,  mouse brain tissue\nPositive FC (Intra) detected in: Caco-2 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSolute carrier family 25 member 46 (SLC25A46), a highly conserved protein among various species including vertebrates, is a nuclear gene encoding mitochondrial carriers. SLC25A46 is involved in mitochondrial fission and the transport of lipids from the endoplasmic reticulum to mitochondria (PMID: 33277645). SLC25A46 has 3 isoforms with molecular weights of 30, 37 and 46 kDa, respectively.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag27293 Product name: Recombinant human SLC25A46 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 222-382 aa of BC017169 Sequence: IETVQSEIIRDNTGILECVKEGIGRVIGMGVPHSKRLLPLLSLIFPTVLHGVLHYIISSVIQKFVLLILKRKTYNSHLAESTSPVQSMLDAYFPELIANFAASLCSDVILYPLETVLHRLHIQGTRTIIDNTDLGYEVLPINTQYEGMRDCINTIRQEEGV Predict reactive species\nFull Name: solute carrier family 25, member 46\nCalculated Molecular Weight: 418 aa, 46 kDa\nObserved Molecular Weight: 46 kDa\nGenBank Accession Number: BC017169\nGene Symbol: SLC25A46\nGene ID (NCBI): 91137\nRRID: AB_3671014\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q96AG3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888516976809,"sku":"83360-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83360-2-rr","provider":"Iright","version":"1.0","type":"link"}