{"product_id":"proteintech-83384-2-rr","title":"Proteintech, 83384-2-RR, NLRC5 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe NLRC5 (83384-2-RR) by Proteintech is a Recombinant antibody targeting NLRC5 in IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n83384-2-RR targets NLRC5 in IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF\/ICC detected in: THP-1 cells\nPositive FC (Intra) detected in: THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe nucleotide-binding domain leucine-rich repeat containing (NLR) family of proteins is mainly involved in microbial pathogen recognition, inflammatory responses, and cell death. NLRC5, the largest member of the NLR family, is currently receiving an increasing level of attention. NLRC5 plays a role in cytokine response and antiviral immunity through its inhibition of NF-kappa-B activation and negative regulation of type I interferon signaling pathways.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag34508 Product name: Recombinant human NLRC5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-160 aa of BC063566 Sequence: MDPVGLQLGNKNLWSCLVRLLTKDPEWLNAKMKFFLPNTDLDSRNETLDPEQRVILQLNKLHVQGSDTWQSFIHCVCMQLEVPLDLEVLLLSTFGYDDGFTSQLGAEGKSQPESQLHHGLKRPHQSCGSSPRRKQCKKQQLELAKKYLQLLRTSAQQRYR Predict reactive species\nFull Name: NLR family, CARD domain containing 5\nCalculated Molecular Weight: 204 kDa\nGenBank Accession Number: BC063566\nGene Symbol: NLRC5\nGene ID (NCBI): 84166\nRRID: AB_3671040\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q86WI3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888862810281,"sku":"83384-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83384-2-rr","provider":"Iright","version":"1.0","type":"link"}