{"product_id":"proteintech-83391-6-rr","title":"Proteintech, 83391-6-RR, NOL11 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe NOL11 (83391-6-RR) by Proteintech is a Recombinant antibody targeting NOL11 in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n83391-6-RR targets NOL11 in WB, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  HT-29 cells,  SW480 cells,  A431 cells\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNOL11, also named as L14, is a ribosome biogenesis factor. It is required for both optimal rDNA transcription and small subunit (SSU) pre-rRNA processing at sites A', A0, 1 and 2b. NOL11 forms a protein complex with two tryptophan-aspartic acid (WD) repeat proteins named WD-repeat protein 43 (WDR43) and Cirhin in mitotic cells. NOL11 plays a role in  pathogenesis of NAIC. There're some isoforms with MW 81 kDa and 19 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag11783 Product name: Recombinant human NOL11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC064404 Sequence: MAALEEEFTLSSVVLSAGPEGLLGVEQSDKTDQFLVTDSGRTVILYKVSDQKPLGSWSVKQGQIITCPAVCNFQTGEYVVVHDNKVLRIWNNEDVNLDKVFKATLSAEVYRILSVQGTEPLVLFKEGAVRGLEALLADPQQKIETVISDEEVIKWTKFFVVFRHPVLIFITEKHGNYFAYVQMFNSRILTKYTLLLGQDENSVIKSFTASVDRKFISLMSLSSDGCIYETLIPIRPADPEKNQSLVKSLLLKAVVSGNARNGVALTALDQDHVAVLGSPLAASKECLSVWNIKFQTLQTSKELPQGTSGQLWYYGEHLFMLHGKSLTVIPYKCEVSSLAGALGKLKHSQDP Predict reactive species\nFull Name: nucleolar protein 11\nCalculated Molecular Weight: 719 aa, 81 kDa\nObserved Molecular Weight: 81 kDa\nGenBank Accession Number: BC064404\nGene Symbol: NOL11\nGene ID (NCBI): 25926\nRRID: AB_3671045\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q9H8H0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888437612713,"sku":"83391-6-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83391-6-rr","provider":"Iright","version":"1.0","type":"link"}