{"product_id":"proteintech-83392-3-rr","title":"Proteintech, 83392-3-RR, GGTLC1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe GGTLC1 (83392-3-RR) by Proteintech is a Recombinant antibody targeting GGTLC1 in WB, ELISA applications with reactivity to human samples\n83392-3-RR targets GGTLC1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, L02 cells,  human urine\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGamma-glutamyltransferase light chain 1 (GGTLC1), initially named GGTL6, then GGTLA4, and later GGTLC1 in 2008, is a member of the gamma-glutamyl transferase (GGT) family. The most ubiquitously expressed human GGT gene, GGT1, encodes a single transmembrane polypeptide that is post-translationally processed to form a heavy and a light chain. Knockdown of GGTLC1 in Endometrial cancer (EC) cells was shown to induce G0\/G1 phase arrest and apoptosis, underscoring the significance of GGTLC1 as a key regulator of these cellular processes in EC (PMID: 38841516).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag11592 Product name: Recombinant human GGTLC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-225 aa of BC040904 Sequence: MTSEFFSAQLRAQISDDTTHPISYYKPEFYMPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILLNNEMDDFSSTSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQITMATALAIIYNLWFGYDVKWAVEEPRLHNQLLPNVTTVERNIDQEVTAALETRHHHTQITSTFIAVVQAIVRMAGGWAAASDSRKGGEPAGY Predict reactive species\nFull Name: gamma-glutamyltransferase light chain 1\nCalculated Molecular Weight: 225 aa, 24 kDa\nObserved Molecular Weight: 20-24 kDa\nGenBank Accession Number: BC040904\nGene Symbol: GGTLC1\nGene ID (NCBI): 92086\nRRID: AB_3671046\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9BX51\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888638513321,"sku":"83392-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83392-3-rr","provider":"Iright","version":"1.0","type":"link"}