{"product_id":"proteintech-83431-1-rr","title":"Proteintech, 83431-1-RR, PLK2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe PLK2 (83431-1-RR) by Proteintech is a Recombinant antibody targeting PLK2 in IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n83431-1-RR targets PLK2 in IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF\/ICC detected in: hTERT-RPE1 cells\nPositive FC (Intra) detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPLK2(Polo-like kinase 2) is also named as SNK and belongs to the Ser\/Thr protein kinase family. It plays a role in normal cell division. Plk2 expression is detected only in G1, and endogenous Plk2 is rapidly turned over. Therefore, the expression of the three mammalian Plks during the cell cycle resembles the successive transition of the cyclins, prompting speculation that Plks may reg-ulate the cell cycle in a manner analogous to that of Cdks(PMID:12972611).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag29837 Product name: Recombinant human PLK2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 357-497 aa of BC013879 Sequence: SSPAKNFFKKAAAALFGGKKDKARYIDTHNRVSKEDEDIYKLRHDLKKTSITQQPSKHRTDEELQPPTTTVARSGTPAVENKQQIGDAIRMIVRGTLGSCSSSSECLEDSTMGSVADTVARVLRGCLENMPEADCIPKEQL Predict reactive species\nFull Name: polo-like kinase 2 (Drosophila)\nCalculated Molecular Weight: 685 aa, 78 kDa\nGenBank Accession Number: BC013879\nGene Symbol: PLK2\nGene ID (NCBI): 10769\nRRID: AB_3671076\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q9NYY3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888864284841,"sku":"83431-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83431-1-rr","provider":"Iright","version":"1.0","type":"link"}